PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100250970061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 287aa    MW: 31635.4 Da    PI: 9.2402
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100250970061genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.5e-32148201255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Ote100250970061|100250970061 148 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 201
                                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.34E-15145201IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-29146201IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-24148201IPR006447Myb domain, plants
PfamPF002493.5E-7149200IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MALEAPDLSL QISPPNISLS PPTTSTKSAA DEGLRRRNAG IRDHHCQFQQ HPQNPNYQIN  60
YLFDGMSPIK GVPVYPNRPF PLPPPAAVSP YFGGALDHQL PAYRMSGGGR FNGLSPPCQL  120
HHGEVSPHGV VRSRFFPRFP AKRSVRAPRM RWTSSLHARF VHAVELLGGH ERATPKSVLE  180
LMDVKDLTLA HVKSHLQMYR TVKTTDKPAA SLDGSGEDDL FPIADGGTGL RLFVDERRPS  240
DESPPQDADC PSTAAAATLW SNSSRXXXXX XXXXXPKHTH TRMCLCV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099922.18e-81PREDICTED: transcription repressor KAN1-like isoform X3
SwissprotQ93WJ99e-59KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A068TZL41e-75A0A068TZL4_COFCA; Uncharacterized protein
STRINGVIT_04s0043g00340.t011e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355